Protein Purification
MilliporeSigma™ Calbiochem™ Dicoumarol
A cell-permeable quinone reductase inhibitor with anticoagulant properties.
MilliporeSigma™ Calbiochem™ SANT-1
A potent, cell-permeable antagonist of the Shh signaling pathway by binding directly to Smoothened, a distant relative of G protein-coupled receptors.
MilliporeSigma™ PureProteome™ Lambda Ig Binder Magnetic Beads
PureProteome™ magnetic beads are a powerful system to isolate antibodies faster, easier and with better reproducibly then ever before.
MilliporeSigma™ Calbiochem™ MK-886
A cell-permeable, orally active NSAID that blocks cellular Cox pathway PGE2 production by inhibiting COX-1 and mPGES-1, but not COX-2, activity, as well as suppresses cellular 5-LO pathway activation by inhibiting FLAP, rather than 5-LO, activity.
MilliporeSigma™ Calbiochem™ Guanosine 3',5'-cyclic Monophosphorothioate, β-Phenyl-1,N2-etheno-8-bromo-, Rp-Isomer, Sodium Salt
A metabolically-stable, competitive inhibitor of protein kinase G types 1α and 1β (Ki = 30 nM).
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ AKR1C1 Inhibitor, 5-PBSA
The AKR1C1 Inhibitor, 5-PBSA, also referenced under CAS 4906-68-7, controls the biological activity of AKR1C1.
MilliporeSigma™ Calbiochem™ MitoBloCK-6
A cell-permeable, stable dichlorosalicylaldehyde Schiff's base that acts as a potent, selective inhibitor of Mia40/Erv1 redox-mediated import pathway (IC50 = 700 nM, 900 nM, an
MilliporeSigma™ Calbiochem™ SR95531 (Gabazine)
A selective, competitive antagonist of GABAA receptor (IC50 = 440nM) that does not affect pentobarbitone or etomidate- induced currents even at high concentrations (∽1
MilliporeSigma™ Calbiochem™ InSolution™ EZH2 Inhibitor, DZNep
A 25 mM (1 mg/98 μL) sterile-filtered solution of Histone Methyltransferase EZH2 Inhibitor, DZNep in H2O.
MilliporeSigma™ Calbiochem™ p38 MAP Kinase Inhibitor III
The p38 MAP Kinase Inhibitor III, also referenced under CAS 581098-48-8, controls the biological activity of p38 MAP Kinase. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ p53 Activator VII, STIMA-1
The p53 Activator VII, STIMA-1, also referenced under CAS 91634-12-7, modulates the biological activity of p53. This small molecule/inhibitor is primarily used for Activators/Inducers applications.
MilliporeSigma™ Calbiochem™ Tiagabine Hydrochloride
A potent uptake inhibitor highly selective for GABA Transport-1 (IC50 = 67nM in vivo
MilliporeSigma™ Calbiochem™ PAD Inhibitor, Cl-amidine
Cl-amidine is a cell-permeable pan PAD inhibitor (IC50 = 0.8, 6.2, and 5.9 μM for PAD1, PAD3, and PAD4, respectively). Inactivates the calcium bound form of PAD4 in an irreversible manner.
Thermo Scientific™ HisPur™ Cobalt Spin Plates
Gently purify His-tagged recombinant fusion proteins using cobalt (Co2+) immobilized metal chelate affinity (IMAC) beads, spin columns and plates.